DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CLEC18C

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:194 Identity:43/194 - (22%)
Similarity:68/194 - (35%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQ 135
            |:|..||.||:      .:..|..| |..|.|...||.||......|.:.      ||...:...
Human    50 LLLSLHNRLRS------WVQPPAAD-MRRLDWSDSLAQLAQARAALCGIP------TPSLASGLW 101

  Fly   136 NLALV--NITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRN-----FAV 193
            ....|  |:.|||     .......|.:..|:.:.        ||:... .|:..||     :..
Human   102 RTLQVGWNMQLLP-----AGLASFVEVVSLWFAEG--------QRYSHA-AGECARNATCTHYTQ 152

  Fly   194 MARDNNTHVGCAALRFEKPAGH-PLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLKYPSLCKA 256
            :....::.:||.  |....||. .:....|.|:..  .:|.:..:..:..:.|:   :.|||.|
Human   153 LVWATSSQLGCG--RHLCSAGQAAIEAFVCAYSPR--GNWEVNGKTIVPYKKGA---WCSLCTA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 36/161 (22%)
CLEC18CNP_775890.2 CAP_euk 50..183 CDD:349399 36/161 (22%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.