DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:204 Identity:46/204 - (22%)
Similarity:74/204 - (36%) Gaps:38/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDS 123
            |.|.:      |..:..||..|     || :|.|..| |..:.|...||.:|.....||..:|:.
Human   115 DPHFI------DNCIEAHNEWR-----GK-VNPPAAD-MKYMIWDKGLAKMAKAWANQCKFEHND 166

  Fly   124 CHNT-----PDFHNSGQNLALVNI-TLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKG 182
            |.:.     ..|...|:|:.|..| :..|           :.:|..|:|::      |...|...
Human   167 CLDKSYKCYAAFEYVGENIWLGGIKSFTP-----------RHAITAWYNET------QFYDFDSL 214

  Fly   183 KLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWPIYKEKAIGCQSG 245
            .......::..:...|:.:||||........|....:..|||  |.|:....|..:.::....|.
Human   215 SCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSK 279

  Fly   246 SDLKYPSLC 254
            .:....:||
Human   280 EEKCVKNLC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 38/163 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.