DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG30486

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:254 Identity:71/254 - (27%)
Similarity:111/254 - (43%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNL-TGLQDLILGEHNALR 80
            |..||:   |..||||...||.....||||:|.|:..:.|..:|.::.. ..::..:|...|..|
  Fly    11 VLISQE---ALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFR 72

  Fly    81 NVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDF------HNSGQNLAL 139
            |.:|.|:..:|....|||||:||.|||.||...:::|....|.|.||.:|      :.|.:.|.|
  Fly    73 NTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQL 137

  Fly   140 VNITLLPEDGNHTDECLVKESIGGWWNQSI-NITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVG 203
                       ..|...|.:.:..:|...: ..|...:......|.|.....|..:.:|...|||
  Fly   138 -----------EKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVG 191

  Fly   204 CA-ALRFEKPAGHPLFLLACNYASNYVPDWPIYKEKA---IGCQSGSDLKYPSLCKAGE 258
            || .||..:.:|...:.:.|:::...:.:..:|:..|   ..|.:|:...|..||...|
  Fly   192 CAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 45/163 (28%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440609
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.