DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and PI16

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001186088.1 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:221 Identity:56/221 - (25%)
Similarity:83/221 - (37%) Gaps:48/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LVNLTG----LQD----LILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCV 118
            ||..||    |.|    |::..||..|..::       |....|..::|..|||..|....:|||
Human    18 LVATTGPVGALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCV 75

  Fly   119 LQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECL-VKESIGGWWNQSINITKEQLQRFPKG 182
            ..|:.     :....|:||..:           |||.: |..::..|.::..:.........|  
Human    76 WGHNK-----ERGRRGENLFAI-----------TDEGMDVPLAMEEWHHEREHYNLSAATCSP-- 122

  Fly   183 KLGDSIRNFAVMARDNNTHVGCAALRFEKPAG---HPLFLLACNY--ASNYVPDWPIYKE--KAI 240
              |....::..:.......:||.:...||..|   ..:.||.|||  ..|.....| |:|  ...
Human   123 --GQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRP-YQEGTPCS 184

  Fly   241 GCQSGSDLKYPSLCK---AGEEYQDL 263
            .|.||...| .|||:   :.|:.|||
Human   185 QCPSGYHCK-NSLCEPIGSPEDAQDL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 36/165 (22%)
PI16NP_001186088.1 SCP_HrTT-1 33..166 CDD:240186 34/159 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.