Sequence 1: | NP_648386.1 | Gene: | CG6628 / 39183 | FlyBaseID: | FBgn0036072 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503189.2 | Gene: | scl-27 / 191204 | WormBaseID: | WBGene00022638 | Length: | 200 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 50/206 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 DLILGEHNALRNVLASGKIIN---LPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFH 131
Fly 132 ----NSGQNLALVNITLLPEDG-NHTDECLVKE----SIGGWWNQSINITKEQLQRFPKGKLGDS 187
Fly 188 IRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIY------KEKAIG--CQS 244
Fly 245 GSDLKYPSLCK 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6628 | NP_648386.1 | SCP_euk | 69..225 | CDD:240180 | 43/166 (26%) |
scl-27 | NP_503189.2 | CAP_euk | 27..164 | CDD:349399 | 42/164 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |