DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and F58E2.5

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:197 Identity:46/197 - (23%)
Similarity:69/197 - (35%) Gaps:68/197 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKI-INLPKPD---------RMATLQWHSELADLATLNVKQCVLQHDSCHN 126
            ||..:|.||:.:|:|.. :.|..||         .|..|:|:..||.||...|..|....|...:
 Worm    43 ILNAYNNLRSEIANGTFTMKLQFPDITIPLAPAAGMLKLKWNCRLAALAQAYVDSCPSYQDLRVH 107

  Fly   127 TPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFP-------KGKL 184
            .|.|.        |..:.|  |.|..:.  :|:.:              |.||.       :|.:
 Worm   108 KPKFP--------VTYSFL--DANLQEH--IKDPV--------------LYRFKILEMDFRRGYI 146

  Fly   185 GDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLK 249
            .|......:.::.    :|||   |...:.:.||:  |           .|||     |...|.|
 Worm   147 NDDWFKKLISSKS----IGCA---FNNCSENVLFV--C-----------YYKE-----QIYEDFK 186

  Fly   250 YP 251
            :|
 Worm   187 FP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 39/169 (23%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 39/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.