DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and scl-1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_502502.1 Gene:scl-1 / 186053 WormBaseID:WBGene00004742 Length:207 Species:Caenorhabditis elegans


Alignment Length:200 Identity:46/200 - (23%)
Similarity:68/200 - (34%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVL--QHDSCHNTP 128
            || |..|:..||.||:.:|....:........||        |:..:.|...|.  ..:..:..|
 Worm    19 TG-QSSIVDAHNKLRSAIAKSTYVAKGTKKEPAT--------DMRKMVVDSTVAASAQNYANTCP 74

  Fly   129 DFHNS----GQNL----ALVNITLLPEDGNHTDECLVKE-SIGGWWNQSINITKEQLQRFPKGKL 184
            ..|:.    |:||    ...::..|...|........|| ...||.:.:::.|     .|..|  
 Worm    75 TGHSKGTGYGENLYWSWTSADVGSLDSYGEIAAAAWEKEFQDFGWKSNAMDTT-----LFNSG-- 132

  Fly   185 GDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFL-------LACNYA-SNYVPDWPIYKEKAIG 241
               |.:...||..|.:.:||..    |..|....:       :.|.|: .......||||| ...
 Worm   133 ---IGHATQMAWANTSSIGCGV----KNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKE-GTT 189

  Fly   242 CQSGS 246
            |.|.|
 Worm   190 CSSCS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 35/173 (20%)
scl-1NP_502502.1 SCP 19..174 CDD:214553 38/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.