DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and scl-24

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_507429.1 Gene:scl-24 / 184188 WormBaseID:WBGene00008575 Length:212 Species:Caenorhabditis elegans


Alignment Length:224 Identity:46/224 - (20%)
Similarity:69/224 - (30%) Gaps:87/224 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DLILGEHNALRNVLASG--KIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHN 132
            |.|:..||.|||..:.|  :..::.|...|..|.|                              
 Worm    32 DNIVFIHNKLRNAASHGLWERYSISKSSNMQLLSW------------------------------ 66

  Fly   133 SGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARD 197
                    |.:|:.|..|....|...:      |:::.|           ||||:|..:.|...|
 Worm    67 --------NESLVAEVENEKYYCEPAD------NKNLPI-----------KLGDNIYQYDVNTYD 106

  Fly   198 NNTHVGCA---------ALRFEKPAGHPLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLKYPS- 252
            :...||..         ||:.|:.|           ..|.:......|.|:|||...|..|..| 
 Worm   107 DIDGVGAMGSINKDTHNALKSEEKA-----------TKNRLRQMLYSKSKSIGCIYESCDKIDSK 160

  Fly   253 ---------LCKAGEEYQDLIGQQGSKGK 272
                     :||.....:::..|...||:
 Worm   161 GINYNTRLVICKYSPPLENIDEQLFDKGE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/165 (19%)
scl-24NP_507429.1 CAP_euk 31..174 CDD:349399 43/207 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.