DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and scl-26

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:217 Identity:45/217 - (20%)
Similarity:86/217 - (39%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 HLVNLTGLQDLILGEHNALRNVLASGKII--NLPKPDRMATLQWHS--------ELADLATLNVK 115
            |..|.|.::.|:. .||.|||..:.|...  |:.|...|..|.|::        |:.|...|..:
 Worm    20 HEWNETAIEGLVF-VHNKLRNDASQGLWARHNISKSTDMQKLFWNNSLVAEAKHEMYDCDQLEKR 83

  Fly   116 QCVLQHDSCHNTPDFHNSGQNLALVNITLLPE-DGNHTDECLVKESIGGWWNQSINITKEQLQRF 179
            :..|              |:|:...::|...: ||...:..:.|:|     :.::: :|:|..::
 Worm    84 ELTL--------------GENIYQYDVTTYDDVDGQQGEAAINKDS-----HDALS-SKDQAAQY 128

  Fly   180 PKGKLGDSIRNFAVMARDNNTHVGC---AALRF-EKPAGHPLFLLACNY--ASNYVPDWPIY--- 235
                     |...::...:|: :||   :..|. ::...:....:.|.|  |...:.| .:|   
 Worm   129 ---------RLRQILYSKSNS-IGCIYESCDRIDDEGTNYNTRFIICKYSPALKNIDD-QLYEEG 182

  Fly   236 KEKAIGCQSGSDLKYP--SLCK 255
            :|....|.||:....|  .||:
 Worm   183 EEACSNCPSGTSCTDPMMKLCE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/172 (19%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 31/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.