DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and C07A4.2

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:144 Identity:34/144 - (23%)
Similarity:56/144 - (38%) Gaps:25/144 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALMLFGFL--QVAFSQDNATAP-PTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQ 69
            ||..|..|  |..:...:|:.| .||..:.....::|.::..|:|  :.||   |....::..|:
 Worm   194 ALDFFSRLTNQKKYDLKSASVPLDTDVKRLSNIGAIKSYLFSKSK--VDKQ---DPARYDIPKLK 253

  Fly    70 DLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSC--HNTPDFHN 132
            :.::..||..|:...:..:|:....|.... :|..|||            .|..|  |..|  ..
 Worm   254 EWLVSYHNVYRSKHGAPALISDSVLDSRGK-RWADELA------------YHKGCLVHEQP--RT 303

  Fly   133 SGQNLALVNITLLP 146
            .|:||.......||
 Worm   304 YGENLFFFGARHLP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 18/80 (23%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.