DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and vap-1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:262 Identity:58/262 - (22%)
Similarity:95/262 - (36%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQDNATAPPTDYCQSGLC------PSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNA 78
            |....|......|::|||      |.::....|.:..:...|...:            .|..||.
 Worm   193 SDAECTTYSDSQCKNGLCYKAPQAPVVETFTMCPSVTDQSDQARQN------------FLDTHNK 245

  Fly    79 LRNVLASGKIIN-------LPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQN 136
            ||..||.|...:       .|...:|..|::...:...|....|.|:.||.:....|..   |:|
 Worm   246 LRTSLAKGLEADGIAAGAFAPMAKQMPKLKYSCTVEANARTWAKGCLYQHSTSAQRPGL---GEN 307

  Fly   137 LALVNITLLPEDGNHTDECLVKESIGGWWNQ-------SINITKEQLQRFPKGKLGDSIRNFAVM 194
            |.:::|..:|:...      .::|...||::       |.||..:.:  |.:|     :.::..|
 Worm   308 LYMISINNMPKIQT------AEDSSKAWWSELKDFGVGSDNILTQAV--FDRG-----VGHYTQM 359

  Fly   195 ARDNNTHVGCAALRFEKPAGHPLFLLA-CNY--ASNYVPDWPIYKEKAIGCQSGSDLKYPSLCKA 256
            |.:..|.:||..      ...|.|..: |.|  |.||: :..|| .|...|.:.:|......|..
 Worm   360 AWEGTTEIGCFV------ENCPTFTYSVCQYGPAGNYM-NQLIY-TKGSPCTADADCPGTQTCSV 416

  Fly   257 GE 258
            .|
 Worm   417 AE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 39/172 (23%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553
SCP 234..386 CDD:214553 40/185 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.