DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CRISP1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:222 Identity:47/222 - (21%)
Similarity:78/222 - (35%) Gaps:73/222 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWH 103
            |:||..|.....:|         :.:|..:|:.|:..|||||..:       :|....|..:.|.
Human    20 SMKKKSARDQFNKL---------VTDLPNVQEEIVNIHNALRRRV-------VPPASNMLKMSWS 68

  Fly   104 SELADLATLNVKQCVLQHDSCHNTP---DFHNS--GQNLALVNITLLPEDGNHTDECLVKESIGG 163
            .|.|..|.:..|.|    |...:.|   ...|:  |:|:   ::|..|...:..        ||.
Human    69 EEAAQNARIFSKYC----DMTESNPLERRLPNTFCGENM---HMTSYPVSWSSV--------IGV 118

  Fly   164 WWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTH--------VGCAALRFEKPAGHPLFLL 220
            |:::|.:.           |.|:.......:..|:.|.        :|| |:...:..|.|.:|.
Human   119 WYSESTSF-----------KHGEWTTTDDDITTDHYTQIVWATSYLIGC-AIASCRQQGSPRYLY 171

  Fly   221 ACNYASNYVPDWPIYKEKAIGCQSGSD 247
            .|:|                 |..|:|
Human   172 VCHY-----------------CHEGND 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 37/168 (22%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 38/188 (20%)
Crisp 195..249 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151267
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.