DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Crisp1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:267 Identity:53/267 - (19%)
Similarity:96/267 - (35%) Gaps:68/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLT--GLQ 69
            :||||..|...|.                |.|||.:..:.:|:.|          .::.|  .:|
Mouse     1 MALMLVLFFLAAV----------------LPPSLLQDSSQENRLE----------KLSTTKMSVQ 39

  Fly    70 DLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQ----CVLQHDSCHNTPDF 130
            :.|:.:||.||.:::       |....:..::|:.:    |.:|.:|    |...|.........
Mouse    40 EEIVSKHNQLRRMVS-------PSGSDLLKMEWNYD----AQVNAQQWADKCTFSHSPIELRTTN 93

  Fly   131 HNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMA 195
            ...|:||.:.:..           .....:|.||:|:..::|.:...:.|...:|    ::..:.
Mouse    94 LRCGENLFMSSYL-----------ASWSSAIQGWYNEYKDLTYDVGPKQPDSVVG----HYTQVV 143

  Fly   196 RDNNTHVGCAALRFEKPAGHPL-FLLACNY--ASNYVPDWPIYKEKAIG--CQSGSDLKYPSLCK 255
            .::...|.|......|   :|| :...|:|  ..||  ...:|.....|  |.|..|.....||.
Mouse   144 WNSTFQVACGVAECPK---NPLRYYYVCHYCPVGNY--QGRLYTPYTAGEPCASCPDHCEDGLCT 203

  Fly   256 AGEEYQD 262
            ....::|
Mouse   204 NSCGHED 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 30/162 (19%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 30/163 (18%)
Crisp 190..244 CDD:285731 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.