DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and GLIPR1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:225 Identity:48/225 - (21%)
Similarity:78/225 - (34%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNT---------PDFH 131
            ||..|:.:.       |....|..:.|...||.:|......|...    |||         |:|.
Human    41 HNKFRSEVK-------PTASDMLYMTWDPALAQIAKAWASNCQFS----HNTRLKPPHKLHPNFT 94

  Fly   132 NSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQ------SINITKEQLQRFPKGKLGDSIRN 190
            :.|:|:...::.:..          |..:|..|:::      ...|.|:....:.:....||.: 
Human    95 SLGENIWTGSVPIFS----------VSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYK- 148

  Fly   191 FAVMARDNNTHVGCAALRFEKPAGHPLFL----LACNY--ASNYVPDWPIYKEKAIGCQS--GSD 247
                       ||||.....|.:|.....    ..|||  ..|| |.|| ||..|. |.:  .:|
Human   149 -----------VGCAVQFCPKVSGFDALSNGAHFICNYGPGGNY-PTWP-YKRGAT-CSACPNND 199

  Fly   248 LKYPSLCKAGEEYQDLIGQQGSKGKRFWTL 277
            ....:||         :.:|..:.||::::
Human   200 KCLDNLC---------VNRQRDQVKRYYSV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 33/169 (20%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151246
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.