DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CRISP3

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:249 Identity:52/249 - (20%)
Similarity:83/249 - (33%) Gaps:67/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMA 98
            :||.||.        .....|..:..|.|...|.:|..|:.:||.||..::       |....|.
Human    43 AGLLPSF--------PANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVS-------PPARNML 92

  Fly    99 TLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGG 163
            .::|:.|.|..|.....||..:|.:..:.......|:||.:                   .|...
Human    93 KMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYM-------------------SSASS 138

  Fly   164 WWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACN----- 223
            .|:|:|....::...|          :|.|..:..|..||    .:.:...:..:|:.|.     
Human   139 SWSQAIQSWFDEYNDF----------DFGVGPKTPNAVVG----HYTQVVWYSSYLVGCGNAYCP 189

  Fly   224 --------YASNYVP--DWP----IYKEKAIGCQSGSDLKYPSLCKAGEEYQDL 263
                    |...|.|  :|.    :..|:...|.|..|.....||..|.:|:||
Human   190 NQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 30/168 (18%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151351
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.