DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and LOC101732829

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:LOC101732829 / 101732829 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:237 Identity:54/237 - (22%)
Similarity:79/237 - (33%) Gaps:78/237 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHD--SCHN 126
            |.|..| :|:..||..|     |.:  .|....|..::|:.|.|..|.:..:.|...|:  |..|
 Frog    78 NATNRQ-IIVDVHNRWR-----GNV--TPTAMNMLKMEWNDEAAKKAEIWARTCNQFHNPASQRN 134

  Fly   127 TPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGK----LGDS 187
            ..:| :.||||.:.                   |....|..::....::::.|..||    .|..
 Frog   135 ITNF-SCGQNLFMA-------------------SYSTTWEAAVTAWFDEIKDFDFGKGPKTFGAL 179

  Fly   188 IRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY---------------------------- 224
            |.::...|..|:..|||  ..||.|.....:...|:|                            
 Frog   180 IGHYTQGAWYNSRMVGC--YEFECPNAEYRYYYVCHYCPAGNIEGKQFTPYKIGPTCGDCPKSCE 242

  Fly   225 ---ASNYVPDWPIYKEKAIGCQ----SGSDLKYPSL---CKA 256
               .:||.|. ||..:   .||    ..|..|||.|   |.|
 Frog   243 NGVCTNYCPH-PINYD---NCQELTTKYSCSKYPELQDDCPA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 38/192 (20%)
LOC101732829XP_017949574.2 CAP 80..217 CDD:412178 39/166 (23%)
Crisp 234..289 CDD:400739 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.