Sequence 1: | NP_648386.1 | Gene: | CG6628 / 39183 | FlyBaseID: | FBgn0036072 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017949574.2 | Gene: | LOC101732829 / 101732829 | -ID: | - | Length: | 290 | Species: | Xenopus tropicalis |
Alignment Length: | 237 | Identity: | 54/237 - (22%) |
---|---|---|---|
Similarity: | 79/237 - (33%) | Gaps: | 78/237 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 NLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHD--SCHN 126
Fly 127 TPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGK----LGDS 187
Fly 188 IRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY---------------------------- 224
Fly 225 ---ASNYVPDWPIYKEKAIGCQ----SGSDLKYPSL---CKA 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6628 | NP_648386.1 | SCP_euk | 69..225 | CDD:240180 | 38/192 (20%) |
LOC101732829 | XP_017949574.2 | CAP | 80..217 | CDD:412178 | 39/166 (23%) |
Crisp | 234..289 | CDD:400739 | 14/51 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |