DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and LOC100536500

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_068070358.2 Gene:LOC100536500 / 100536500 -ID:- Length:185 Species:Danio rerio


Alignment Length:150 Identity:33/150 - (22%)
Similarity:57/150 - (38%) Gaps:40/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 MATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLVKES- 160
            |..:.|...:|:.|...:.:|    :..|..|    |.:.|          :|....|.|.|.: 
Zfish     1 MLKMSWSDAVAESARGWINKC----NMTHGPP----SSRML----------NGYEMGENLFKATG 47

  Fly   161 IGGW------WNQSINITKEQLQRFPKGKL-GDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLF 218
            |..|      |:..:|..|     :|.|.: |.:..::..:...::..||||..:    .|...|
Zfish    48 ISSWTSVVDAWHSEVNNYK-----YPIGSINGQATGHYTQVVWYSSYEVGCAVTQ----CGSNYF 103

  Fly   219 LLACNY--ASNY--VPDWPI 234
             ..|:|  |.|:  ||.:.:
Zfish   104 -YGCHYYRAGNFRTVPPYSL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 29/137 (21%)
LOC100536500XP_068070358.2 None

Return to query results.
Submit another query.