DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and LOC100536500

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:191 Identity:43/191 - (22%)
Similarity:71/191 - (37%) Gaps:47/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQ 120
            ||.......|:.:|..|:..|||.|..:.       |....|..:.|...:|:.|...:.:|   
Zfish    27 CSVTGVCTELSSVQQEIVDVHNAFRRAVQ-------PSASNMLKMSWSDAVAESARGWINKC--- 81

  Fly   121 HDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLVKES-IGGW------WNQSINITKEQLQR 178
             :..|..|    |.:.|          :|....|.|.|.: |..|      |:..:|..|     
Zfish    82 -NMTHGPP----SSRML----------NGYEMGENLFKATGISSWTSVVDAWHSEVNNYK----- 126

  Fly   179 FPKGKL-GDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNY--VPDWPI 234
            :|.|.: |.:..::..:...::..||||..:    .|...| ..|:|  |.|:  ||.:.:
Zfish   127 YPIGSINGQATGHYTQVVWYSSYEVGCAVTQ----CGSNYF-YGCHYYRAGNFRTVPPYSL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 36/165 (22%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.