DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and r3hdml

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:178 Identity:37/178 - (20%)
Similarity:63/178 - (35%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPD--FHNSG 134
            :|..||.:|:.:       .|....|..:.|...||..|.....||...|.     |:  ....|
 Frog    66 LLDYHNQVRSKV-------FPPAANMEYMVWDERLAKSAESWANQCKWDHG-----PNQLMRYIG 118

  Fly   135 QNLALVNITLLPEDGNHTDECLVKESIGGWWNQ----SINITKEQLQRFPKGKLGDSIRNFAVMA 195
            |||::       ..|.:..   :.:.:.||:::    |....:|.....|....|....::..|.
 Frog   119 QNLSV-------HSGRYRS---IVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMV 173

  Fly   196 RDNNTHVGCAA-----LRFEKPAGHPLFLLACNYA--SNYVPDWPIYK 236
            ..::..:|||.     :............|.|||:  .|::.:.| ||
 Frog   174 WASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAP-YK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/163 (20%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.