DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and crisp1.11

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:210 Identity:47/210 - (22%)
Similarity:75/210 - (35%) Gaps:51/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFH- 131
            ::.:|:..|||.|...:       |....|..:.|:.:.|:.|......|.    ..|:.||.. 
 Frog    59 VRQIIIDTHNAYRRNAS-------PSARNMLKMVWNEDAANNAASWSAGCT----GSHSPPDKRT 112

  Fly   132 ----NSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKG---KLGDS-I 188
                :.|:||.|.:.....|           |::..|::::        :.|..|   |..|. :
 Frog   113 IPGFSCGENLFLASYPASWE-----------EAVKAWFDEN--------ESFEYGVGPKSPDQVV 158

  Fly   189 RNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNY--VPDWPIYK--EKAIGCQSGSD 247
            .::..:...|:..|||:....  |.....:...|.|  |.|.  |.:.| ||  .|...|....|
 Frog   159 GHYTQVMWYNSYMVGCSVSYC--PKSQYKYFYVCQYCPAGNIEGVMNTP-YKAGPKCADCVEACD 220

  Fly   248 LKYPSLCKAGEEYQD 262
               .|||.....|||
 Frog   221 ---NSLCTNYCPYQD 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/166 (19%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 32/167 (19%)
Crisp 212..263 CDD:400739 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.