DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and crispld1a

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:273 Identity:56/273 - (20%)
Similarity:90/273 - (32%) Gaps:69/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TELVVALMLF-----GFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHL 62
            |..|.|::||     |||...:.:|:|.....|            .:..:.:|:         ..
Zfish    18 TRTVFAMVLFNATDLGFLLEKYLEDDADDDAGD------------RVMERQRGK---------RA 61

  Fly    63 VNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNT 127
            :..:.:| .||..||.||     |::  .|....|..:.|.:||...|....:.|:.:|......
Zfish    62 ITASDMQ-AILDLHNKLR-----GQV--YPPASNMEYMVWDNELERSAEEWAETCLWEHGPAGLL 118

  Fly   128 PDFHNSGQNLALVNITLLPEDGNHTDECLVKES-IGGWWNQ----SINITKEQLQRFPKGKLGDS 187
            |..   ||||           |.|........| :..|:::    |....:|.....|....|..
Zfish   119 PQI---GQNL-----------GVHWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPV 169

  Fly   188 IRNFAVMARDNNTHVGCAA-----LRFEKPAGHPLFLLACNYAS-----NYVPDWPIYKEKAIGC 242
            ..::..:....::.:|||.     :............|.|||:.     .|.|    ||. ...|
Zfish   170 CTHYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAP----YKH-GTSC 229

  Fly   243 QSGSDLKYPSLCK 255
             |.....|..:|:
Zfish   230 -SACPPSYGGVCR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 35/165 (21%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 35/165 (21%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585694
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.