DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and XB5812873

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:269 Identity:59/269 - (21%)
Similarity:86/269 - (31%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LC-PSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMAT 99
            || .||.|..:.::..|...:.|.|     |...::.|:.:||..|:      .:|.|..| |..
 Frog    38 LCLASLSKPTSEQDSVESFDEMSTD-----LESNRNFIVDKHNYYRS------WVNPPAAD-MLK 90

  Fly   100 LQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGW 164
            :.|.:.....|    |:..|.....|:...|...|...|..||  :.....|:.|.:    |..|
 Frog    91 MHWDNYYLAKA----KEWALTCSFKHSNLSFRQYGGEFAGENI--MNSYFRHSWEYV----INYW 145

  Fly   165 WNQSIN------ITKEQLQR----------------------------------FPKGKLGDSIR 189
            :|:.:|      .|||....                                  :|.|...|.::
 Frog   146 FNEHVNWEYAVGTTKEGAVTGHFTQIIWAPTHALACYVAKCYGTPYNYFYVCIYYPTGNREDKVK 210

  Fly   190 NFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLKYPSLC 254
            .    ...|.|..|..    :|.....|.|       ||.|    |...|..|  |:| |..|||
 Frog   211 T----PYQNGTTCGLC----QKDCDDQLCL-------NYCP----YYNSAGNC--GTD-KNASLC 253

  Fly   255 KAGEEYQDL 263
                :|.|:
 Frog   254 ----DYSDI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 36/195 (18%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 27/152 (18%)
Crisp 219..269 CDD:400739 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.