DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and PRY2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:27/133 - (20%)
Similarity:50/133 - (37%) Gaps:18/133 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQSNVREMTILA---------E 154
            |:|.|::.||. :.....|...:|..:....|||:.:.....:..|.......||         :
Yeast   195 SMVNEHNTKRA-LHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTGSVD 258

  Fly   155 QWLDEL--YDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNL 217
            .|.:|:  ||..:.....:.|....::...:|.:||........|..:  ::|.|.:.    ||:
Yeast   259 AWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDY--IICSYKAA----GNV 317

  Fly   218 YEE 220
            ..|
Yeast   318 IGE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 23/119 (19%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344553
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.