DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and PRY3

DIOPT Version :10

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:38/174 - (21%)
Similarity:60/174 - (34%) Gaps:58/174 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDF 124
            |...:|..||.:|.     |.||..|      |.|.:.|:..|:                     
Yeast    25 FESDVLNEHNKFRA-----LHVDTAP------LTWSDTLATYAQ--------------------- 57

  Fly   125 SEPHFNYAEDFYPRPVIRQSNVREMTILA---------EQWLDEL--YDLDDIATYSAEGEIRNI 178
                 |||:.:....|:..|:......||         :.|..|:  |:..:.....:.|....:
Yeast    58 -----NYADQYDCSGVLTHSDGPYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQV 117

  Fly   179 INDRSSYMGCAAGQDY--DLWNIHFVLVCYYSSGPPVEGNLYEE 220
            :...::.:||  |..|  ..||.:  :||.|:  ||  ||...|
Yeast   118 VWKSTAEIGC--GYKYCGTTWNNY--IVCSYN--PP--GNYLGE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 CAP_euk 61..208 CDD:349399 31/159 (19%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 37/171 (22%)
ser_rich_anae_1 <449..>709 CDD:468206
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.