DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and AT1G50050

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:151 Identity:29/151 - (19%)
Similarity:50/151 - (33%) Gaps:50/151 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHF 129
            |..||..|.:|.            :..:|||..::..|..:....::|     |..|.....   
plant    31 LNTHNTARAQVG------------VANVVWDTVVAAYATNYANARKVD-----CSLTPSTGG--- 75

  Fly   130 NYAEDFYPRPVIRQSNVREMTILA--EQWLDE--LYDLDDIATYSAE----------------GE 174
            :|.|:      :...|....|.:|  ..|::|  .|:....|...|:                |.
plant    76 SYGEN------LANGNNALFTGVAAVNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIGC 134

  Fly   175 IRNIINDRSSYMGCAAGQDYD 195
            .|.:.|:...::||    :||
plant   135 ARVLCNNGGYFVGC----NYD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 29/151 (19%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 27/149 (18%)
Radical_SAM <155..185 CDD:302752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.