DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:222 Identity:49/222 - (22%)
Similarity:72/222 - (32%) Gaps:76/222 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVAT---- 121
            :|.:|.|||..|.:|.       |.|..|..:.||:.|...|.....:|..:....|.:.:    
Human    56 KEEILMLHNKLRGQVQ-------PQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQN 113

  Fly   122 -----DDFSEPHFN----YAE--DF-YPRP----------------------VIRQSN------- 145
                 ..:..|.|:    |.|  |: ||.|                      |...:|       
Human   114 LGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVN 178

  Fly   146 -VREMTILAEQWLDELYDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFVLVCYYSS 209
             .|:||:..|.|.:.:|   .:..||.:|   |.|.:.....|....:            |..|.
Human   179 TCRKMTVWGEVWENAVY---FVCNYSPKG---NWIGEAPYKNGRPCSE------------CPPSY 225

  Fly   210 GPPVEGNL-YEEGIFNATLCPNGQSDE 235
            |.....|| |.|    .|..|..::||
Human   226 GGSCRNNLCYRE----ETYTPKPETDE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 39/192 (20%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 32/154 (21%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151214
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.