DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Crispld1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:243 Identity:56/243 - (23%)
Similarity:77/243 - (31%) Gaps:89/243 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDN 96
            |||.| .||:|                   :.:|.|||..|.:|       .|.|..|..:.||.
Mouse    53 GKRAI-TDNDM-------------------QSILDLHNKLRSQV-------YPTASNMEYMTWDV 90

  Fly    97 YLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQS------NVREMTILAEQ 155
            .|...||...:.|..:....|.:                   |.|.|:      ..|..|...:.
Mouse    91 ELERSAESWAEMCLWEHGPASLL-------------------PSIGQNLGAHWGRYRPPTFHVQA 136

  Fly   156 WLDELYDL--------DDIATYSAEGEI----RNIINDRSSYMGCAA---------GQDYDLWNI 199
            |.||:.|.        |....:...|.:    ..::...||.:|||.         ||   :|..
Mouse   137 WYDEVRDFSYPYENECDPYCPFRCSGPVCTHYTQVVWATSSRIGCAVNLCHNMNIWGQ---IWPK 198

  Fly   200 HFVLVCYYSSGPPVEGNLYEEGIFN----ATLCP---NGQSDEYPNLC 240
            ...|||.||.    :||.:....:.    .:.||   .|...|  |||
Mouse   199 AVYLVCNYSP----KGNWWGHAPYKHGRPCSACPPSFGGGCRE--NLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/173 (22%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 39/192 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.