DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:247 Identity:56/247 - (22%)
Similarity:77/247 - (31%) Gaps:97/247 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDN 96
            |||.| .||:|                   :.:|.|||..|.:|       .|.|..|..:.||.
Human    53 GKRAI-TDNDM-------------------QSILDLHNKLRSQV-------YPTASNMEYMTWDV 90

  Fly    97 YLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQS------NVREMTILAEQ 155
            .|...||...:.|..:....|.:                   |.|.|:      ..|..|...:.
Human    91 ELERSAESWAESCLWEHGPASLL-------------------PSIGQNLGAHWGRYRPPTFHVQS 136

  Fly   156 WLDELYDLDDIATYSAEGEIR----------------NIINDRSSYMGCAA---------GQDYD 195
            |.||:.|.    :|..|.|..                .::...|:.:|||.         ||   
Human   137 WYDEVKDF----SYPYEHECNPYCPFRCSGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQ--- 194

  Fly   196 LWNIHFVLVCYYSSGPPVEGNLYEEGIFN----ATLCP---NGQSDEYPNLC 240
            :|.....|||.||.    :||.:....:.    .:.||   .|...|  |||
Human   195 IWPKAVYLVCNYSP----KGNWWGHAPYKHGRPCSACPPSFGGGCRE--NLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/177 (21%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 38/176 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.