DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and AT5G57625

DIOPT Version :10

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:40 Identity:11/40 - (27%)
Similarity:19/40 - (47%) Gaps:4/40 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SNLFVD----LPPAQKMPELVWDNYLSVVAEYHLKRCQMD 112
            :.||:|    |.....:|.|:||..|:..|.:...:.:.|
plant    72 ARLFLDPHNALRSGLGLPPLIWDGKLASYATWWANQRRYD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 CAP_euk 61..208 CDD:349399 11/40 (28%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 11/40 (28%)

Return to query results.
Submit another query.