DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and AT5G02730

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:66/163 - (40%) Gaps:41/163 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDD--- 123
            |:||. ||..|  |||.          ...|.||..|:..|....|:.:.|     |..|..   
plant    59 EFLLA-HNAAR--VASG----------ASNLRWDQGLARFASKWAKQRKSD-----CKMTHSGGP 105

  Fly   124 FSEPHFNY--AEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEI----RNIINDR 182
            :.|..|.|  :|::.||.|:            ::|:||..:.|.:|.....|.:    ..|:...
plant   106 YGENIFRYQRSENWSPRRVV------------DKWMDESLNYDRVANTCKSGAMCGHYTQIVWRT 158

  Fly   183 SSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEG 215
            ::.:|||..:..:  |..|:::|.||.....||
plant   159 TTAVGCARSKCDN--NRGFLVICEYSPSGNYEG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/154 (25%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 42/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.