DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and AT4G30320

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:188 Identity:40/188 - (21%)
Similarity:62/188 - (32%) Gaps:60/188 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHL 106
            ||...:|      .:.|.::|..:|..|..|..:            ::..|.||..|:..|::..
plant    14 MMLLVTC------CHCATYQEQFMGPQNAARAHL------------RLKPLKWDAKLARYAQWWA 60

  Fly   107 KRCQMDLPDDSCVATDDFSEPHFN--YAEDFYPRPVIRQSNVREMTILAEQWLDEL--YDLDDIA 167
            .:.:.|     |..|      |.|  |.|:.:    ....|....:..|..||.|.  |:....:
plant    61 NQRRGD-----CALT------HSNGPYGENLF----WGSGNRWGPSQAAYGWLSEARSYNYRSNS 110

  Fly   168 TYSAE-GEIRNIINDRSSYMGCAAGQDYDLWNIHFV--------LVCYYSSGPPVEGN 216
            ..|.. |....|:...:..:|||          |.:        |.|.|.  ||  ||
plant   111 CNSEMCGHYTQIVWKNTQKIGCA----------HVICNGGGGVFLTCNYD--PP--GN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 31/159 (19%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.