DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and AT4G07820

DIOPT Version :10

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:66 Identity:16/66 - (24%)
Similarity:24/66 - (36%) Gaps:23/66 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DIATYSAEGEIRNIINDRSSY----MGCAAGQDYDLW-------------------NIHFVLVCY 206
            ||..:|||..:...:|.:|.|    ..|.||:..|.:                   |..|:.:|.
plant    84 DIIDFSAEEFVSTFLNQKSDYDYTTNTCRAGKSCDGYKQVLFRKSVFLGCAKVKCNNGGFLAICS 148

  Fly   207 Y 207
            |
plant   149 Y 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 CAP_euk 61..208 CDD:349399 16/66 (24%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 16/66 (24%)

Return to query results.
Submit another query.