DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and PRB1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:151 Identity:28/151 - (18%)
Similarity:48/151 - (31%) Gaps:35/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYA 132
            ||..|.::.      :.|.|      ||..|:..|..:..:.:.|     |         ...::
plant    37 HNQARSQIG------VGPMQ------WDEGLAAYARNYANQLKGD-----C---------RLVHS 75

  Fly   133 EDFYPRPVIRQSNVREMTILAEQWLDEL--YDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYD 195
            ...|...:.:.............|::|.  |:.|........|....::...|..:|||..:   
plant    76 RGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDTNTCNGVCGHYTQVVWRNSVRLGCAKVR--- 137

  Fly   196 LWNIHFVLVCYYSSGPPVEGN 216
            ..|...::.|.|.  ||  ||
plant   138 CNNGGTIISCNYD--PP--GN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 23/141 (16%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.