DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Crisp4

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:208 Identity:42/208 - (20%)
Similarity:72/208 - (34%) Gaps:72/208 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRC--------QMDLPDDS 117
            :|.::..||.:|::|:       |||:.|.::.|.:..:..|....:.|        :..||:..
Mouse    85 QEEIVNTHNAFRRKVS-------PPARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLPNTF 142

  Fly   118 CVATDDFSEPHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRNIIND- 181
            |..         |...:.||         ...:.:.|.|.:|       :.|...||..:..:| 
Mouse   143 CGE---------NMLMEHYP---------SSWSKVIEIWFNE-------SKYFKYGEWPSTDDDI 182

  Fly   182 ----------RSSYM-GCAAGQDYDLWNIHFVLVCYYSSGPPVEGN-------LYEEGIFNATLC 228
                      .|:|: ||............::.||:|..    |||       .|:||       
Mouse   183 ETDHYTQMVWASTYLVGCDVAACRRQKAATYLYVCHYCH----EGNHQDTLNMPYKEG------- 236

  Fly   229 PNGQSDEYPNLCK 241
              ...|:.||.|:
Mouse   237 --SPCDDCPNNCE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 31/166 (19%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.