DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Crisp3

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:217 Identity:44/217 - (20%)
Similarity:74/217 - (34%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMD-LPDDSCVATDDF 124
            :|.::..||..|:.|:       |....:..:.||:...|.|:....||..: .|......|...
  Rat    41 QEEIINKHNQLRRTVS-------PSGSDLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKC 98

  Fly   125 SEPHF--NYAEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAE------GEIRNIIND 181
            .|..|  ||...:              :.:.:.|.||  .||.:..:..:      |....::.:
  Rat    99 GENLFMANYPASW--------------SSVIQDWYDE--SLDFVFGFGPKKVGVKVGHYTQVVWN 147

  Fly   182 RSSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLY----------------EEGIFNATLCPN 230
            .:..:.|...:..| ..:.:..||:|..|....|.||                |:|     ||.|
  Rat   148 STFLVACGVAECPD-QPLKYFYVCHYCPGGNYVGRLYSPYTEGEPCDSCPGNCEDG-----LCTN 206

  Fly   231 G--QSDEYPN---LCKTLTLND 247
            .  ..|.|.|   |.|.::.:|
  Rat   207 SCEYEDNYSNCGDLKKMVSCDD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 28/155 (18%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 29/156 (19%)
Crisp 192..246 CDD:285731 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.