DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and r3hdml

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:199 Identity:43/199 - (21%)
Similarity:72/199 - (36%) Gaps:54/199 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPH 128
            ||..||..|.:|       .|||..|..:|||..|:..||:...:|..:            ..||
Zfish    69 LLDYHNRVRSQV-------FPPAANMEYMVWDERLAKSAEFWASQCIWE------------HGPH 114

  Fly   129 FNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDLD-------DIATYSAEGEIRNIINDRSSYM 186
             ::.:.......|.....:.:..|.:.|.||.:...       .:.|:..:     ::...|:.:
Zfish   115 -HFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSRCSGSVCTHYTQ-----MVWAASNKI 173

  Fly   187 GCAAGQDYD------LWNIHFVLVCYYSSGPPVEGNLYEEGIFN----ATLCPN--------GQS 233
            |||..:..|      :|....:|||.|:    ::||...|..:.    .:.||:        .|.
Zfish   174 GCAIKKCSDIFVFGSMWKQATLLVCNYA----IKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234

  Fly   234 DEYP 237
            |..|
Zfish   235 DSRP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 34/156 (22%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 34/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585746
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.