DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:182 Identity:42/182 - (23%)
Similarity:70/182 - (38%) Gaps:50/182 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQM-DLPDDS----CV 119
            |.:..|.:||..|::|.       |||..|.:::||..|:.:|:...:.|:: ..|..|    |:
Mouse    41 FIDAFLNIHNELRRKVQ-------PPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCL 98

  Fly   120 ATDDFSEPHFNYAE-DFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRNIINDRS 183
            ...||...:....| :..|..|:            ..|.:|..|.             |.:::..
Mouse    99 LDYDFIGENIYLGEIETQPEDVV------------NNWYNENTDY-------------NFVDNTC 138

  Fly   184 SYMGCAAGQDYD--LWNIHFVLVCYYSSGPPVEGNL--YEEGIFNATLCPNG 231
            |.: |   ::|.  :|...|.:.|..|:.|    ||  |..|:|.....|.|
Mouse   139 SKI-C---RNYTQLVWAKTFKIGCAVSNCP----NLTRYSAGLFVCNYSPTG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 32/154 (21%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 41/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.