DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and PI15

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:258 Identity:56/258 - (21%)
Similarity:83/258 - (32%) Gaps:95/258 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IDFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPA 86
            :|..||.....||:|. .|:|:                   .:|..||..|.:|       .|||
Human    48 LDSADIPKARRKRYIS-QNDMI-------------------AILDYHNQVRGKV-------FPPA 85

  Fly    87 QKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHF-NYAEDFYPRPV-IRQSNVREM 149
            ..|..:|||..|:..||.....|..|               |. :|...|..:.: :|....|.:
Human    86 ANMEYMVWDENLAKSAEAWAATCIWD---------------HGPSYLLRFLGQNLSVRTGRYRSI 135

  Fly   150 TILAEQWLDELYD-----------------LDDIATYSAEGEIRNIINDRSSYMGCA--AGQDYD 195
            ..|.:.|.||:.|                 ...:.|:..:     ::...|:.:|||  ..|:.:
Human   136 LQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQ-----MVWATSNRIGCAIHTCQNMN 195

  Fly   196 LWNIHF----VLVCYY------------------SSGPPVEGNLYEEGIFNATLCPNGQSDEY 236
            :|...:    .|||.|                  ||.||..|     |.....||..|.:..|
Human   196 VWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYG-----GSCTDNLCFPGVTSNY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/189 (20%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 38/190 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.