DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Ag5r2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster


Alignment Length:250 Identity:64/250 - (25%)
Similarity:119/250 - (47%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQLTLFLCKILFLRSILAIDFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNM-AYFREYLLGL 67
            ::|.|....|:.|....|.|:|....|:|..||.|.::..:|.||.....|::: ..::...:..
  Fly     1 MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHS 65

  Fly    68 HNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYA 132
            ||..|..:|.....:...|.:|..:.||:.|:.:|..::::|.|  ..|||..||.|.....|.|
  Fly    66 HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNM--VHDSCHNTDAFKYSGQNLA 128

  Fly   133 EDFYPRPVIRQSNVREMTILAEQWLDELYDLDD--IA-----TYS--AEGEIRNIINDRSSYMGC 188
            ...|...:.....:.:.::  :.|.||:::.:.  ||     .|:  |.|....::::|::.:||
  Fly   129 WQAYSGDLPDMGYILDNSV--QMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGC 191

  Fly   189 AAGQ-DYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPNGQSDEYPNLCKT 242
            ||.: :.|.|| ..::.|.|::...:...:|....:.|..|.:|.:.|:.|||.|
  Fly   192 AAARYNRDGWN-QVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCST 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/156 (24%)
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.