DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG8483

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:247 Identity:57/247 - (23%)
Similarity:92/247 - (37%) Gaps:60/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFLRSILAIDFCDIK-SCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVAS 77
            :.|.:|:.|. |::. :|:||               :...|:.  |..|..:|..||..||.||:
  Fly     7 VLLTTIMIIS-CEVAFACNGK---------------IIASGIT--AEERSIILQEHNRLRQIVAT 53

  Fly    78 NLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIR 142
            ..:...|.|:.|.|:|||:.|:..|:.....||..            .:||         |.:.|
  Fly    54 GRYPGQPGAENMREIVWDDELAARAQKWADNCQFR------------HDPH---------RTINR 97

  Fly   143 QSNVREMTIL----------------AEQWLDEL--YDLDDIATYSAEGEIRNIINDRSSYMGCA 189
            .:..:.:.|:                .:.|.:|:  |...| |.....|....::...:|.:||.
  Fly    98 FTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD-AWSPKTGHYSQLVWGETSLVGCG 161

  Fly   190 AGQDYDLWNIHFVLVCYYSSGPPVEG-NLYEEGIFNATLCPNGQSDEYPNLC 240
            ..:..|....:.:.||.|..|..|.| |.||.|..:.:......|..|..||
  Fly   162 YAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 36/164 (22%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/164 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.