DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and scpr-A

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:118/260 - (45%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLFLCKILFLRSILAIDFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNG 70
            |.|.|..::.:.|  |:|:|.:.:|..| |:.|:|...|.|:|.:....|.:....:.:|.|.|.
  Fly     7 LQLILLAVVAISS--AVDYCALPTCLDK-HVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNE 68

  Fly    71 YRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDF-----SEPHFN 130
            .|..||......||.|.:|.::.|...||.:|..::|.|: .|| |.|.:|:.|     :...|.
  Fly    69 LRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCE-SLP-DKCRSTERFAYAGQNNALFQ 131

  Fly   131 Y--AEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRN--------IINDRSSY 185
            |  ||..|....|.:..:       |.|..|..:.......|...|:.|        .:.:::::
  Fly   132 YSGAETEYTDAEIIKEEI-------ENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTH 189

  Fly   186 MGCAAGQ-DYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPN--GQSDEYPNLCKTLTLND 247
            :||||.: ..|.:| ||||.|.:::...|...:|..|....|.|.|  |.:.:|||||....:.|
  Fly   190 VGCAAVRFSRDFYN-HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 253

  Fly   248  247
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 45/162 (28%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.