DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and scpr-C

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:74/257 - (28%)
Similarity:116/257 - (45%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILFLRSILAI----DFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQ 73
            ::.|.|:|.|    |:|.:.:|..| ||.|:|...|.|:|.:....|.:....:.:|.|.|..|.
  Fly     6 LILLTSLLGISLAADYCALPTCLDK-HIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRN 69

  Fly    74 EVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDF-----SEPHFNY-- 131
            .||......||.|.:|.::.|...||.:|..::|.|: .|| |.|.:|:.|     :...|.|  
  Fly    70 NVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCE-SLP-DKCRSTERFAYAGQNNAVFQYSG 132

  Fly   132 AEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRN--------IINDRSSYMGC 188
            ||..|....|.:..:       |.|..|..:.......|...|:.|        .:.::::::||
  Fly   133 AETEYTDAEIIKEQI-------ENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 190

  Fly   189 AAGQ-DYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPN--GQSDEYPNLCKTLTLND 247
            ||.: ..|.:| ||||.|.:::...|...:|..|....|.|.|  |.:.:|||||....:.|
  Fly   191 AAVRFSRDFYN-HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 45/162 (28%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.