DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG11977

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:184 Identity:45/184 - (24%)
Similarity:78/184 - (42%) Gaps:23/184 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DFCDIKSC-HGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPA 86
            |:|:...| ..|:||.| ....:...|.|.|..|.|:.:|..::...|.:|:::...| .:||.|
  Fly    43 DYCNADICPANKKHITC-GFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGL-GNLPRA 105

  Fly    87 QKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQSNVREMTI 151
            .|...:.||:.|||:|.....:| :......||.|  |.......:.||    |..|:..:...:
  Fly   106 VKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNT--FLYKDVGESSDF----VKVQNTSKGFNV 163

  Fly   152 LA--EQWLD--------ELYDLDDIATYSAEGEIRNIINDRSSYMGCA---AGQ 192
            ::  ..|.:        .:.:..:||.........|:|.:::..|||.   :||
  Fly   164 ISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVKSGQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 33/145 (23%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 33/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.