DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG31482

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster


Alignment Length:187 Identity:45/187 - (24%)
Similarity:66/187 - (35%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELV--WDNYLSVVAEYHLKRCQMDLPDDSCV 119
            :|..:|..|..||..|::..|      ||.....||.  .:.|..|:|...              
  Fly    19 IADLQEDHLNEHNRLREKHGS------PPLTLDDELTKGCEEYAKVLANNE-------------- 63

  Fly   120 ATDDFSEPHFNYAEDFYPRPVIRQSNVREMTIL--AEQWLDEL--YDLDDIATYSAEGEIRNIIN 180
            ..:..|....||.|:..         :|..|.|  .:.|.||:  ||.:......:.|....::.
  Fly    64 KLEHSSSAGQNYGENLC---------MRSQTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVW 119

  Fly   181 DRSSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCP--NGQSDE 235
            ..:..||  .||..|....::|:..||   |||..|    |.|...:.|  .|:.||
  Fly   120 KNAKKMG--IGQAKDKKGYYWVVARYY---PPVNVN----GQFEENVLPPIKGEGDE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 33/152 (22%)
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.