Sequence 1: | NP_648384.1 | Gene: | CG8072 / 39181 | FlyBaseID: | FBgn0036070 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_989314.1 | Gene: | crisp1.7 / 394939 | XenbaseID: | XB-GENE-5779195 | Length: | 244 | Species: | Xenopus tropicalis |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 76/195 - (38%) | Gaps: | 75/195 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFS 125
Fly 126 EPHFNYA---EDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGE--IRNIINDRSSY 185
Fly 186 --------MGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPN-GQSDEYPNLCK 241
Fly 242 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8072 | NP_648384.1 | SCP_euk | 61..208 | CDD:240180 | 29/159 (18%) |
crisp1.7 | NP_989314.1 | CAP_CRISP | 32..171 | CDD:349402 | 40/195 (21%) |
Crisp | 188..243 | CDD:369954 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |