DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and crisp1.7

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:195 Identity:40/195 - (20%)
Similarity:76/195 - (38%) Gaps:75/195 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFS 125
            |:.::.:||.||:  ::|     |.|..|.::.|    |:.||.:.|                  
 Frog    34 RQKIVDIHNAYRR--SAN-----PTASNMLKMSW----SIEAENNAK------------------ 69

  Fly   126 EPHFNYA---EDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGE--IRNIINDRSSY 185
                |:|   ..::.:|..||  :..:|.     .:.|:    :::|.|..|  |:::.::..::
 Frog    70 ----NWATTCNQYHSQPAARQ--IANITC-----GENLF----MSSYPASWEEVIQSLHSEYDNF 119

  Fly   186 --------MGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPN-GQSDEYPNLCK 241
                    :|...|        |:..|.:|.|        |..|.: .|.||| |...:|..:|:
 Frog   120 EYGVGAKAVGLVIG--------HYTQVMWYKS--------YRIGCY-CTECPNDGVRLKYYYVCQ 167

  Fly   242  241
             Frog   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 29/159 (18%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 40/195 (21%)
Crisp 188..243 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.