DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG34002

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:269 Identity:73/269 - (27%)
Similarity:124/269 - (46%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLFLCKILFLRSILAIDFCDIKSCHGKR---HIGCDNNMMFDESCLRFHGLVNM-AYFREYLLG 66
            |.||...::||  :...::|.:|:|...:   ||||:|:..:...|.:...:::: .:.::.:|.
  Fly    12 LLLFGLNLVFL--LPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILN 74

  Fly    67 LHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNY 131
            .||.||..||......||.|.:|.:|.||:.|:::|...:|||.:. |.|.|::|::||.|.::.
  Fly    75 HHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQ-PTDHCISTEEFSSPSYHA 138

  Fly   132 AEDFYPRPVIRQSNVREMTILAEQWLDELYD------LDDIATYSAE-GEIRNIINDRSSYMGCA 189
            .   |.:...::...|.:......|.|:...      :|.::|...| |....:|...|:.:|||
  Fly   139 V---YNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCA 200

  Fly   190 -AGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPNGQSDEYPNLC------------- 240
             |..:...|. |..|.|.||..|.....|||........|..|.:.::.|||             
  Fly   201 IASIEKGGWT-HQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTEPVKDCMHSE 264

  Fly   241 --KTLTLND 247
              :|:|.||
  Fly   265 LFQTITAND 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 44/154 (29%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 44/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4141
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.