DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG34049

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:286 Identity:53/286 - (18%)
Similarity:88/286 - (30%) Gaps:121/286 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IGCDNNMMFDE---SCLRFHGLVNMAYFREYLLGLHNG-------YRQEVASNLFVDLPPAQKMP 90
            ||||::....|   |||       .::.|:.:...||.       .::..:.|....||  .|.|
  Fly    26 IGCDSSNRDLEKCRSCL-------TSFCRKPIKIYHNSRNYLACEVQRSQSINSIKSLP--VKFP 81

  Fly    91 ---------ELVWDNYLSVVAEYHLKRC-QMDLP-----DDSCVATDDFSEPHFNYAEDF--YPR 138
                     |..|.         |.||| |...|     ..|.:.:....:...:..::|  |..
  Fly    82 STPNRSLNTEKDWS---------HGKRCLQCAAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKI 137

  Fly   139 PVIRQSNVREMTI-----------------------LAEQWLDELYDLDDIAT------------ 168
            |:||:..:::..:                       .|::|.|.|.||:.:.|            
  Fly   138 PIIRRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMR 202

  Fly   169 -----YSAE------------------------GEIRNIINDRSSYMGCAAGQDY-DLWNIHFVL 203
                 :|.:                        |....::...|.::|.....|. .:|     :
  Fly   203 VRRSKFSVDQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIW-----I 262

  Fly   204 VCYYSSGPPVEGNLYEEGIFNATLCP 229
            ||.|.  ||  ||:.|.  |...:.|
  Fly   263 VCNYH--PP--GNVSEH--FRENVLP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 37/235 (16%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 19/134 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.