DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG43775

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:259 Identity:59/259 - (22%)
Similarity:97/259 - (37%) Gaps:66/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREY-------------------LLGLHNGYRQ-- 73
            |:.:.|: ||       ...|.|.:..:...:.|                   .|.:.|.:|.  
  Fly    24 CNNRTHV-CD-------LAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDML 80

  Fly    74 -----EVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAE 133
                 :.|.|  ...|.|::|..|.||:.|:.:|..|  ...:......|.:|..|  |......
  Fly    81 AGGELDTAEN--KTFPSAKRMRALQWDSELAYMARTH--AATVSFMHSECRSTLRF--PLAGEVL 139

  Fly   134 DFYPRPVIRQSNVRE-MTILAEQWLDELYDLDDIATYS---------AEGEIRNIINDRSSYMGC 188
            ...| ||..:.::.| :.::.....||...:.|..:::         :.|....|:|||.|.:||
  Fly   140 ALSP-PVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGC 203

  Fly   189 --AAG----QDYDLWNIHFVLVCYYSSGPPVEGN-LYEEGIFNATLCPNG----QSDEYPNLCK 241
              |.|    :|..:...|| |.|::.. ..|.|: :|:.|  .||...|.    .|.:|.|||:
  Fly   204 GFAVGSNCEKDGKVGFCHF-LTCHFDY-TNVNGSYVYKTG--KATTGCNDWKTIASIKYSNLCE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 41/188 (22%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.