DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:239 Identity:52/239 - (21%)
Similarity:82/239 - (34%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLFLCKI-LFLRSILAIDFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHN 69
            |.|:||:: |.|.|                 .|.:..:..:|         ::.:..|| :.|||
  Rat    24 LKLWLCELWLLLMS-----------------SGLNAKLPLEE---------DVDFINEY-VNLHN 61

  Fly    70 GYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRC------QMDLPDDSCVATDDFSEPH 128
            ..|..|       .||...:..:.||..||..|....|:|      .:|...:|.....|..|..
  Rat    62 ELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPVFTDIGENM 119

  Fly   129 FNYAE-DFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGE----IRNIINDRSSYMGC 188
            :...| ||.....||            .|.:|....:.:.....|.|    ...::.|.|..:||
  Rat   120 WVGPEKDFTATNAIR------------SWHEERKSYNYVNDTCIEDEDCSHYIQLVWDHSYKVGC 172

  Fly   189 AAGQDYDLWNIHF--VLVCYYSSGPPVEGNLYEEGIFNATLCPN 230
            |......:..|.:  :.:|.|:.|..:....|:.|.| .:.|.|
  Rat   173 AVTPCAKVGAITYAALFICNYAPGGTLTRRPYQAGQF-CSRCTN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 36/159 (23%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.