DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Clec18a

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:247 Identity:50/247 - (20%)
Similarity:84/247 - (34%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILFLRSILAIDFCDIKSCHGKRHIGCDNNMMF---DESCLRFHGLVNMAYFREYLLGLHNGYRQE 74
            :|.|.|:|.|.:.:::....|:    |..:..   .||.|              :|..||..|..
Mouse    94 LLLLLSLLGITWTEVQPPQPKQ----DPTLQALSRKESFL--------------ILTAHNRLRSR 140

  Fly    75 VASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRP 139
            |.       |||..|..:.|...|:.:||.....|...:..:  :|:......|..:  :....|
Mouse   141 VH-------PPAANMQRMDWSESLAQLAEARAALCVTSVTPN--LASTPGHNSHVGW--NVQLMP 194

  Fly   140 VIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFVLV 204
            :...|.|..:.:...:.|...:...:.|..:.......::...||.:||.....:.........|
Mouse   195 MGSASFVEVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFV 259

  Fly   205 CYYSSGPPVEGNL---------YEEGIFNATLCPNGQS------DEYPNLCK 241
            |.||.|    ||.         |::|.: .:||....|      |....||:
Mouse   260 CAYSPG----GNWDINGKTVAPYKKGTW-CSLCTARVSGCFKAWDHAGGLCE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 27/146 (18%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 28/158 (18%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.