DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG9400

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:227 Identity:63/227 - (27%)
Similarity:95/227 - (41%) Gaps:35/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HIGCDNNMMFDESCLRFHGLVNMA-YFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYL 98
            |..|.||..|..:|.....|:.|: ..|:.||.:||..|.::||........|..||.|.||..|
  Fly    69 HTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTEL 133

  Fly    99 SVVAEYHLKRCQMDLPDDSCVATD--DFSEPHFNY---AEDFYPRPVIRQSNVREMTILAEQWLD 158
            ..:|..|.||||  ...|.|..|.  .||..:..|   ..:|       :|:.|.|......|..
  Fly   134 EQMAALHAKRCQ--FAHDKCRNTPRFKFSGQNIGYFWIGREF-------KSHSRRMKSFVINWFR 189

  Fly   159 ELYDLDD--IATYSAE------GEIRNIINDRSSYMGCAAGQDYDLWN--IHFVLVCYYSSGPPV 213
            |..|.:.  |..|...      |....:::||.:.:|||..:..:..:  ..|:|.|.|.     
  Fly   190 EHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD----- 249

  Fly   214 EGNLYEEGIFNA----TLCPNGQ-SDEYPNLC 240
            ..|::.|.|:.:    :.||..: |:::|:||
  Fly   250 YNNIFNEPIYQSGPAGSKCPQHRISEKFPSLC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 45/161 (28%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.